PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10009130
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family MYB
Protein Properties Length: 305aa    MW: 34653.5 Da    PI: 9.5986
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10009130genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding513.3e-161461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd ll ++++ +G g+W+ ++ + g++R++k+c++rw++yl
      Lus10009130 14 KGAWTEEEDRLLRKCIASFGEGRWHQVPLRAGLNRCRKSCRLRWLNYL 61
                     79********************************************97 PP

2Myb_DNA-binding48.22.6e-1567111147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg ++++E +l+ +++k+lG++ W++Ia +++ gRt++++k++w+++
      Lus10009130  67 RGEFSEDEVDLITRLHKLLGNR-WSLIAGRLP-GRTANDVKNYWNTH 111
                      899*******************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129425.528965IPR017930Myb domain
SuperFamilySSF466891.05E-2711108IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.1E-211164IPR009057Homeodomain-like
SMARTSM007174.6E-151363IPR001005SANT/Myb domain
PfamPF002491.8E-151461IPR001005SANT/Myb domain
CDDcd001671.24E-101661No hitNo description
Gene3DG3DSA:1.10.10.607.9E-2365115IPR009057Homeodomain-like
SMARTSM007172.1E-1566114IPR001005SANT/Myb domain
PROSITE profilePS5129418.83566116IPR017930Myb domain
PfamPF002497.3E-1467111IPR001005SANT/Myb domain
CDDcd001673.78E-1069111No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 305 aa     Download sequence    Send to blast
MEGGEMQSTV GLRKGAWTEE EDRLLRKCIA SFGEGRWHQV PLRAGLNRCR KSCRLRWLNY  60
LKPNIKRGEF SEDEVDLITR LHKLLGNRWS LIAGRLPGRT ANDVKNYWNT HQKKKTASFQ  120
CNPSYTNNNK SEQFKKNNNN NNNNNNDAKL QITKNNIIKP RPRTFSSKSF FWAGKKITTK  180
PQNPAFITNK PRNVDDDVSK KRSYHQMRGS GGESTWADQL ERFLNDGGVV NDDDGSPAAG  240
INGGHEADVI NRTGKLIWSD NDEEKNNNMG DIGTTTMFDG QDDHNQSCWS DIDIWDLLGD  300
HRGI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A1e-21121162105MYB PROTO-ONCOGENE PROTEIN
1mse_C1e-21121162105C-Myb DNA-Binding Domain
1msf_C1e-21121162105C-Myb DNA-Binding Domain
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002534011.21e-69PREDICTED: transcription factor MYB113
SwissprotQ9FNV98e-64MY113_ARATH; Transcription factor MYB113
TrEMBLB9T6Z26e-70B9T6Z2_RICCO; R2r3-myb transcription factor, putative (Fragment)
STRINGPOPTR_0005s14480.14e-64(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF3134817
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G66370.11e-62myb domain protein 113